missing translation for 'onlineSavingsMsg'
Learn More

Acetyl-coenzyme A transporter 1 Antibody (3A4), Novus Biologicals™

Product Code. 18338758 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18338758 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18338758 Supplier Novus Biologicals Supplier No. H00009197M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Acetyl-coenzyme A transporter 1 Monoclonal antibody specifically detects Acetyl-coenzyme A transporter 1 in Human, Mouse, Rat, Hamster samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen Acetyl-coenzyme A transporter 1
Applications Western Blot, ELISA, Immunocytochemistry, KnockDown
Classification Monoclonal
Clone 3A4
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004724
Gene Alias ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant)
Host Species Mouse
Immunogen SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9197
Target Species Human, Mouse, Rat, Hamster
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.