missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Acetyl-CoA Carboxylase alpha/ACACA Rabbit anti-Human, Mouse, Rat, Clone: 5J4W7, Novus Biologicals™

Acetyl-CoA Carboxylase alpha/ACACA Rabbit anti-Human, Mouse, Rat, Clone: 5J4W7, Novus Biologicals™

Product Code. 18398144 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18398144 20 μg 20µL
18304984 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18398144 Supplier Novus Biologicals Supplier No. NBP31574420UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Acetyl-CoA Carboxylase alpha/ACACA Monoclonal antibody specifically detects Acetyl-CoA Carboxylase alpha/ACACA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Acetyl-CoA Carboxylase alpha/ACACA
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 5J4W7
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Acetyl-CoA Carboxylase alpha/ACACA (Q13085). RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Lipid and Metabolism, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 31
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.