missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACCSL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-70401
This item is not returnable.
View return policy
Description
ACCSL Polyclonal specifically detects ACCSL in Human samples. It is validated for Western Blot.
Specifications
| ACCSL | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like, ACC synthase-like protein 2,1-aminocyclopropane-1-carboxylate synthase-like protein 2 | |
| Rabbit | |
| 65 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q4AC99 | |
| ACCSL | |
| Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected from the N terminal of LOC390110 (NP_001027025). Peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR. | |
| Affinity purified | |
| RUO | |
| 390110 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction