missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACBP Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | ACBP |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunoprecipitation 1:500 - 1:1000 |
| Applications | Western Blot, Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654442
|
Novus Biologicals
NBP2-92457-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604442
|
Novus Biologicals
NBP2-92457-0.1ml |
0.1 mL |
£359.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACBP Polyclonal antibody specifically detects ACBP in Human samples. It is validated for Western Blot, ImmunoprecipitationSpecifications
| ACBP | |
| Western Blot, Immunoprecipitation | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS with 50% glycerol, pH7.3. | |
| 1622 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunoprecipitation 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| acyl-Coenzyme A binding domain containing 1, acyl-Coenzyme A bindingprotein), CCK-RP, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), Diazepam-binding inhibitor, endozepine, EP, GABA receptor modulator, MGC70414 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ACBP (NP_001171513.1). MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title