ACADVL Antibody (5D3), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00000037-M01

Product Code. 18335048

Description

ACADVL Monoclonal antibody specifically detects ACADVL in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ACADVL
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: ACAD6, acyl-CoA dehydrogenase, very long chain, acyl-Coenzyme A dehydrogenase, very long chain, EC 1.3.99, EC 1.3.99.-, LCACD, very long-chain specific acyl-CoA dehydrogenase, mitochondrial, VLCAD
• Immunogen: ACADVL (NP_000009, 345 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI
• Quantity: 0.1 mg
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 37
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2b κ

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Clone: 5D3
• Dilution: Western Blot 1:500
• Gene Accession No.: NP_000009
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified