missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ACADSB Rabbit anti-Human, Polyclonal, Novus Biologicals™

ACADSB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18376153
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18376153 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18376153 Supplier Bio-Techne Supplier No. NBP317009100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ACADSB Polyclonal antibody specifically detects ACADSB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ACADSB
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 2-MEBCAD, 2-methylbutyryl-coenzyme A dehydrogenase, ACAD7,2-methylbutyryl-CoA dehydrogenase, acyl-CoA dehydrogenase, short/branched chain, acyl-Coenzyme A dehydrogenase, short/branched chain, EC 1.3.99,2-methyl branched chain acyl-CoA dehydrogenase, EC 1.3.99.-, SBCADshort/branched chain specific acyl-CoA dehydrogenase, mitochondrial
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQN
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 36
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.