missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACAD10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £486.00
Specifications
| Antigen | ACAD10 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18622869
|
Novus Biologicals
NBP2-49511-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18606746
|
Novus Biologicals
NBP2-49511 |
0.1 mL |
£486.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACAD10 Polyclonal antibody specifically detects ACAD10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ACAD10 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2), 40% Glycerol | |
| 80724 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ACAD-10, acyl-CoA dehydrogenase family member 10, acyl-CoA dehydrogenase family, member 10, acyl-Coenzyme A dehydrogenase family, member 10, EC 1.3.99.-, MGC5601 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title