missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACAA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-54746
This item is not returnable.
View return policy
Description
ACAA2 Polyclonal specifically detects ACAA2 in Human samples. It is validated for Western Blot.
Specifications
| ACAA2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 3-ketoacyl-CoA thiolase, mitochondrial, Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 2, acetyl-Coenzyme A acyltransferase 2, beta ketothiolase, beta-ketothiolase, DSAEC, EC 2.3.1, EC 2.3.1.16, FLJ35992, FLJ95265, Mitochondrial 3-oxoacyl-CoA thiolase, mitochondrial 3-oxoacyl-Coenzyme A thiolase, T1 | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P42765 | |
| ACAA2 | |
| Synthetic peptides corresponding to ACAA2(acetyl-Coenzyme A acyltransferase 2) The peptide sequence was selected from the N terminal of ACAA2. Peptide sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV. | |
| Affinity purified | |
| RUO | |
| 10449 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction