ABP1/AOC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-89067-25ul

Product Code. 18454091

Description

ABP1/AOC1 Polyclonal specifically detects ABP1/AOC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ABP1/AOC1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ABP, amiloride binding protein 1 (amine oxidase (copper-containing)), Amiloride-binding protein, amiloride-sensitive amine oxidase, amiloride-sensitive amine oxidase [copper-containing], AOC1DAOamiloride-binding protein-1, DAO1, Diamine oxidase, EC 1.4.3, EC 1.4.3.22, Histaminase, KAO, Kidney amine oxidase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: AOC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFA
• Quantity: 25 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 26
• Target Species: Human
• Isotype: IgG

For Research Use Only