missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABL2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | ABL2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227885
|
Novus Biologicals
NBP3-33205-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229684
|
Novus Biologicals
NBP3-33205-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ABL2 Monoclonal antibody specifically detects ABL2 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| ABL2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 27 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Abelson murine leukemia viral (v-abl) oncogene homolog 2, Abelson murine leukemia viral oncogene homolog 2, Abelson-related gene protein, Abelson-relatedgene), arg tyrosine kinase, EC 2.7.10, EC 2.7.10.2, FLJ22224, FLJ31718, FLJ41441, tyrosine-protein kinase ABL2, Tyrosine-protein kinase ARG, v-abl Abelson murine leukemia viral oncogene homolog 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ABL2 (P42684).,, Sequence:, KGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title