ABI2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92201-0.1ml

Product Code. 18628181

Description

ABI2 Polyclonal antibody specifically detects ABI2 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: ABI2
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: Abelson interactor 2, Abi-2, ABI2B, abl binding protein 3, abl interactor 2, Abl-binding protein 3, AblBP3ABI-2, abl-interacting protein 1 (SH3-containing protein), abl-interactor 2, abl-interactor protein 2b, AIP-1, arg protein tyrosine kinase-binding protein, Arg-binding protein 1, argBP1, ARGBPIA, argBPIB, SSH3BP2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1). HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRT
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 10152
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified