ABI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57842-25ul

Product Code. 18674417

Description

ABI1 Polyclonal specifically detects ABI1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ABI1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Abelson interactor 1, ABI-1, abl interactor 1, Abl-binding protein 4, AblBP4, abl-interactor 1, Abl-interactor protein 1 long, E3B1, eps8 binding protein, Eps8 SH3 domain-binding protein, Eps8-binding protein, interactor protein AblBP4, nap1 binding protein, Nap1-binding protein, Nap1BP, spectrin SH3 domain binding protein 1, Spectrin SH3 domain-binding protein 1, SSH3BP, SSH3BP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10006
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ABI1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only