missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABHD13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ABHD13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABHD13 Polyclonal specifically detects ABHD13 in Human samples. It is validated for Western Blot.Specifications
| ABHD13 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| abhydrolase domain containing 13, abhydrolase domain-containing protein 13, bA153I24.2, BEM46L1, C13orf6, chromosome 13 open reading frame 6, EC 3.-, FLJ14906, MGC27058, RP11-153I24.2 | |
| ABHD13 | |
| IgG | |
| 38 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q7L211 | |
| 84945 | |
| Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected from the N terminal of ABHD13. Peptide sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title