missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABHD10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | ABHD10 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217242
|
Novus Biologicals
NBP2-57747 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627858
|
Novus Biologicals
NBP2-57747-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ABHD10 Polyclonal specifically detects ABHD10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ABHD10 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| abhydrolase domain containing 10, EC 3.4, FLJ11342, mitochondrial | |
| ABHD10 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 55347 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title