ABCG1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-05328-20ul

Product Code. 18663057

Description

ABCG1 Polyclonal antibody specifically detects ABCG1 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: ABCG1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000
• Gene Alias: ABC transporter 8, ABC8, ABCG1, ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette transporter member 1 of subfamily G, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), WHITE1, WHT1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ABCG1 (NP_004906.3). MACLMAAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTL
• Quantity: 20 μg
• Research Discipline: ABC Transporters, Cancer, Cholesterol Metabolism, Diabetes Research, Lipid and Metabolism, Neuroscience, Signal Transduction
• Gene ID (Entrez): 9619
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified