ABCF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-89318-25ul

Product Code. 18413501

Description

ABCF2 Polyclonal antibody specifically detects ABCF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ABCF2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: ABC28, ABC-type transport protein, ATP-binding cassette sub-family F member 2, ATP-binding cassette, sub-family F (GCN20), member 2, DKFZp586K1823, EC 3.6.3, EC 3.6.3.17, EST133090, HUSSY18, HUSSY-18, Iron inhibited ABC transporter 2, Iron-inhibited ABC transporter 2, M-ABC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
• Quantity: 25 μL
• Research Discipline: ABC Transporters, Chromatin Research, DNA replication Transcription Translation and Splicing, Lipid and Metabolism, Membrane Trafficking and Chaperones, Signal Transduction
• Gene ID (Entrez): 10061
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified