missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ABCD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABCD4 Polyclonal specifically detects ABCD4 in Human samples. It is validated for Western Blot.Specifications
| ABCD4 | |
| Polyclonal | |
| Rabbit | |
| O14678 | |
| 5826 | |
| Synthetic peptides corresponding to ABCD4(ATP-binding cassette, sub-family D (ALD), member 4) The peptide sequence was selected from the N terminal of ABCD4. Peptide sequence YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ATP-binding cassette sub-family D member 4, ATP-binding cassette, sub-family D (ALD), member 4, EST352188, P70R69 kDa peroxisomal ABC-transporter, Peroxisomal membrane protein 1-like, Peroxisomal membrane protein 69, PMP69P79R, PMP70-related protein, PXMP1-L, PXMP1LABC41 | |
| ABCD4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title