missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ABCD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABCD2 Polyclonal specifically detects ABCD2 in Human samples. It is validated for Western Blot.Specifications
| ABCD2 | |
| Polyclonal | |
| Rabbit | |
| Q9UBJ2 | |
| 225 | |
| Synthetic peptides corresponding to ABCD2(ATP-binding cassette, sub-family D (ALD), member 2) The peptide sequence was selected from the middle region of ABCD2. Peptide sequence WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein, ALD1, ALDL1ATP-binding cassette sub-family D member 2, ALDRhALDR, ALDRPABC39, ATP-binding cassette, sub-family D (ALD), member 2 | |
| ABCD2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title