missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCD1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | ABCD1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228319
|
Novus Biologicals
NBP3-33443-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228226
|
Novus Biologicals
NBP3-33443-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ABCD1 Monoclonal antibody specifically detects ABCD1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| ABCD1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| ABC Transporters, Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 215 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Adrenoleukodystrophy protein, ALDATP-binding cassette sub-family D member 1, ALDPadrenoleukodystrophy, AMNABC42, ATP-binding cassette, sub-family D (ALD), member 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 650-745 of human ABCD1 (NP_000024.2).,, Sequence:, AGIALLSITHRPSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQRRLQELCQILGEAVAPAHVPAPSPQGPGGLQGAST | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title