missing translation for 'onlineSavingsMsg'
Learn More

ABCC9 Antibody (S319A-14), Janelia Fluor™ 646, Novus Biologicals™

Product Code. 18419266 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18419266 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18419266 Supplier Novus Biologicals Supplier No. NBP222403JF646

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ABCC9 Monoclonal antibody specifically detects ABCC9 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ABCC9
Applications Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone S319A-14
Conjugate Janelia Fluor 646
Formulation 50mM Sodium Borate
Gene Alias ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9
Host Species Mouse
Immunogen Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Purification Method Protein G purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cellular Signaling, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers
Primary or Secondary Primary
Gene ID (Entrez) 10060
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Form Purified
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.