missing translation for 'onlineSavingsMsg'
Learn More

ABCC11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£285.00 - £423.00

Specifications

Antigen	ABCC11
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18137427 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-38192	0.1 mL	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A View alternative products Save Up to »

18672776 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-38192-25ul	25 μL	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A View alternative products Save Up to »

Description

ABCC11 Polyclonal specifically detects ABCC11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ABCC11
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ATP-binding cassette protein C11, ATP-binding cassette transporter MRP8, ATP-binding cassette transporter sub-family C member 11, ATP-binding cassette, sub-family C (CFTR/MRP), member 11, EWWD, MRP8ATP-binding cassette sub-family C member 11, Multidrug resistance-associated protein 8, multi-resistance protein 8, WW
Gene Symbols	ABCC11
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q96J66
Gene ID (Entrez)	85320
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: RIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGEIIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIV
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

ABCC11 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents