ABCB10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69065

Product Code. 18253692

Description

ABCB10 Polyclonal specifically detects ABCB10 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: ABCB10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 77 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5FVL8
• Gene Symbols: Abcb10
• Immunogen: The immunogen for anti-Abcb10 antibody: synthetic peptide corresponding to a region of Rat (NP_001012166). Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23456
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.