missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ABCA8 Polyclonal antibody specifically detects ABCA8 in Human, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | ABCA8 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 50% glycerol, pH7.3 |
| Gene Alias | ATP-binding cassette sub-family A member 8, ATP-binding cassette, sub-family A (ABC1), member 8, EC 3.6.3, EC 3.6.3.41, KIAA0822MGC163152 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 425-495 of human ABCA8 (NP_009099.1). NEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAIRIRNVTKEYKGKPDK |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?