ABCA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18403001	Novus Biologicals NBP1-84780-25ul	25ul
18291266	Novus Biologicals NBP1-84780	0.1 mL

Description

ABCA5 Polyclonal specifically detects ABCA5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ABCA5
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q8WWZ7
• Gene ID (Entrez): 23461
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Phosphatase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ABC13, ATP-binding cassette A5, ATP-binding cassette sub-family A member 5, ATP-binding cassette, sub-family A (ABC1), member 5, DKFZp451F117, DKFZp779N2435, EC 3.6.3, EC 3.6.3.25, EC 3.6.3.41, EST90625, FLJ16381, KIAA1888
• Gene Symbols: ABCA5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only