missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ABCA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ABCA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18395063
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18395063 25 μg 25µL
18352047 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18395063 Supplier Bio-Techne Supplier No. NBP31733325UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ABCA4 Polyclonal antibody specifically detects ABCA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ABCA4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias ABC10, ABCRRMP, ARMD2DKFZp781N1972, ATP binding cassette transporter, ATP-binding cassette sub-family A member 4, ATP-binding cassette transporter, retinal-specific, ATP-binding cassette, sub-family A (ABC1), member 4, ATP-binding transporter, retina-specific, CORD3, EC 3.6.3, FFMFLJ17534, photoreceptor rim protein, retinal-specific ATP-binding cassette transporter, retina-specific ABC transporter, RIM ABC transporter, RIM protein, RmP, RP19, Stargardt disease protein, STGD, STGD1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline ABC Transporters, Lipid and Metabolism, Vision
Primary or Secondary Primary
Gene ID (Entrez) 24
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.