missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AASDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | AASDH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AASDH Polyclonal specifically detects AASDH in Human samples. It is validated for Western Blot.Specifications
| AASDH | |
| Polyclonal | |
| Rabbit | |
| Q4L235 | |
| 132949 | |
| Synthetic peptides corresponding to AASDH(aminoadipate-semialdehyde dehydrogenase) The peptide sequence was selected from the middle region of AASDH. Peptide sequence TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ACSF4acyl-CoA synthetase family member 4, aminoadipate-semialdehyde dehydrogenase, EC 6.2.1.-, LYS2, non-ribosomal peptide synthetase 1098, non-ribosomal peptide synthetase 998,2-aminoadipic 6-semialdehyde dehydrogenase, NRPS1098, NRPS998, Protein NRPS998, U26 | |
| AASDH | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title