missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AASD-PPT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £443.00
Specifications
| Antigen | AASD-PPT |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18485741
|
Novus Biologicals
NBP1-89322-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18239056
|
Novus Biologicals
NBP1-89322 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AASD-PPT Polyclonal specifically detects AASD-PPT in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| AASD-PPT | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| Q9NRN7 | |
| 60496 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 36 kDa |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Proteases & Other Enzymes | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4'-phosphopantetheinyl transferase, AASD-PPTDKFZp566E2346, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, CGI-80, EC 2.7.8, EC 2.7.8.-, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS2, LYS5, LYS5 ortholog | |
| AASDHPPT | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title