missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AADACL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | AADACL4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AADACL4 Polyclonal specifically detects AADACL4 in Human samples. It is validated for Western Blot.Specifications
| AADACL4 | |
| Polyclonal | |
| Rabbit | |
| NP_001013652 | |
| 343066 | |
| Synthetic peptide directed towards the middle region of human AADACL4. Peptide sequence IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| arylacetamide deacetylase-like 4 | |
| AADACL4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title