missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AADAC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | AADAC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AADAC Polyclonal specifically detects AADAC in Human samples. It is validated for Western Blot.Specifications
| AADAC | |
| Polyclonal | |
| Rabbit | |
| P22760 | |
| 13 | |
| Synthetic peptides corresponding to AADAC(arylacetamide deacetylase (esterase)) The peptide sequence was selected from the N terminal of AADAC. Peptide sequence AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| arylacetamide deacetylase, arylacetamide deacetylase (esterase), CES5A1, DACEC 3.1.1.3, EC 3.1.1, EC 3.1.1.79 | |
| AADAC | |
| IgG | |
| 46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title