Novus Biologicals™ 6 Phosphofructo 2 Kinase Recombinant Protein Antigen

Product Code. 18255052

Brand: Novus Biologicals™ NBP255403PEP

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 6 Phosphofructo 2 Kinase. Source: E.coli Amino Acid Sequence: YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV The 6 Phosphofructo 2 Kinase Recombinant Protein Antigen is derived from E. coli. The 6 Phosphofructo 2 Kinase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifikationer

• Gene ID (Entrez): 5209
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: 6 Phosphofructo 2 Kinase Recombinant Protein Antigen
• Content And Storage: −20°C, avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase, 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, FLJ37326, inducible 6-phosphofructo-2-kinase/fruct
• Gene Symbol: PFKFB3
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51435. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.