missing translation for 'onlineSavingsMsg'
Learn More
Learn More
58K Golgi Protein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48601
This item is not returnable.
View return policy
Description
58K Golgi Protein Polyclonal antibody specifically detects 58K Golgi Protein in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| 58K Golgi Protein | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| formimidoyltransferase cyclodeaminase, formimidoyltransferase-cyclodeaminase, formiminotransferase cyclodeaminase, Formiminotransferase-cyclodeaminase, human formiminotransferase cyclodeaminase, EC 4.3.1.410formiminotransferase-cyclodeaminase, LCHC1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEH | |
| 0.1 mL | |
| Cellular Markers, Golgi Apparatus Markers, Lipid and Metabolism, Signal Transduction | |
| 10841 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction