TGF-beta 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-80289

Product Code. 18778083

Description

TGF-beta 1 Polyclonal specifically detects TGF-beta 1 in Human, Mouse, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TGF-beta 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CEDLAP, DPD1, latency-associated peptide, TGFB, TGFbeta, TGF-beta 1 protein, TGF-beta-1, transforming growth factor beta-1, transforming growth factor, beta 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 5-10 ug/ml, Immunohistochemistry-Paraffin 5-10 ug/ml, Imaging Mass Cytometry
• Gene Accession No.: NP_035707
• Gene Symbols: TGFB1
• Immunogen: Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7040
• Target Species: Human, Mouse, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Goat, Sheep
• Isotype: IgG

For Research Use Only