missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
5-HT6 Polyclonal specifically detects 5-HT6 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | 5-HT6 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | 5-hydroxytryptamine (serotonin) receptor 6,5-HT65-HT6R, Serotonin receptor 6,5-HT-6,5-hydroxytryptamine receptor 6 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human 5-HT6 (NP_000862.1). Peptide sequence VANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?