5-HT2B Antibody (4A4), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00003357-M01-100ug

Artikelnummer. 18350639

Beschreibung

5-HT2B Monoclonal antibody specifically detects 5-HT2B in Human samples. It is validated for Western Blot, ELISA

Spezifikation

• Antigen: 5-HT2B
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Accession No.: NP_000858
• Host Species: Mouse
• Purification Method: Protein A or G purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, ELISA
• Clone: 4A4
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: 5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B
• Immunogen: HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
• Quantity: 100 μg
• Research Discipline: GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 3357
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ