missing translation for 'onlineSavingsMsg'
Learn More
Learn More
5-HT1F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | 5-HT1F |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18446001
|
Novus Biologicals
NBP1-90319 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18413802
|
Novus Biologicals
NBP1-90319-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
5-HT1F Polyclonal antibody specifically detects 5-HT1F in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| 5-HT1F | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol | |
| 3355 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 5-HT-1F, 5HT6, 5-hydroxytryptamine (serotonin) receptor 1F, HTR1EL, HTR1ELMR77,5-HT1F5-hydroxytryptamine receptor 1F, Serotonin receptor 1F | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title