missing translation for 'onlineSavingsMsg'
Learn More
Learn More
26S proteasome subunit 9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-47561-25ul
This item is not returnable.
View return policy
Description
26S proteasome subunit 9 Polyclonal specifically detects 26S proteasome subunit 9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| 26S proteasome subunit 9 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| 26S proteasome non-ATPase regulatory subunit 9, p27, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9, Rpn4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PSMD9 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR | |
| 25 μL | |
| Breast Cancer, Cancer, Tumor Suppressors | |
| 5715 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction