TRNT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Brand:  Novus Biologicals NBP1-86589-25ul

Product Code. 18443131

Description

TRNT1 Polyclonal specifically detects TRNT1 in Human, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: TRNT1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 ug/mL, Simple Western 1:8, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200-1:500, Knockdown Validated
• Gene Accession No.: Q96Q11
• Gene Symbols: TRNT1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIR
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51095
• Target Species: Human, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CCA1, CCA-adding, CGI-47, EC 2.7.7.72, mitochondrial CCA-adding tRNA-nucleotidyltransferase, mt CCA-adding enzyme, mt tRNA adenylyltransferase, mt tRNA CCA-diphosphorylase, mt tRNA CCA-pyrophosphorylase, MtCCA, tRNA nucleotidyl transferase, CCA-adding, 1, tRNA-nucleotidyltransferase 1, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 50 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TRNT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only