SYDE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58432-25ul

Product Code. 18645647

Description

SYDE2 Polyclonal specifically detects SYDE2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SYDE2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: FLJ13815, rho GTPase-activating protein SYDE2, RP11-33E12.1, synapse defective 1, Rho GTPase, homolog 2 (C. elegans), synapse defective protein 1 homolog 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84144
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SYDE2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPIPMSKECTFQTYLTMQTIESTVDRKNNLKDLQESIDTLIGN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only