17 beta-HSD14/HSD17B14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-85220

Product Code. 18235456

Description

17 beta-HSD14/HSD17B14 Polyclonal specifically detects 17 beta-HSD14/HSD17B14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 17 beta-HSD14/HSD17B14
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: dehydrogenase/reductase (SDR family) member 10, Dehydrogenase/reductase SDR family member 10, DHRS1017-beta-hydroxysteroid dehydrogenase 14, EC 1.1.1.-, hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10, retinal short-chain dehydrogenase/reductase 3, Retinal short-chain dehydrogenase/reductase retSDR3, retSDR3, RETSDR3,17-beta-HSD 14, SDR3, SDR47C1, short chain dehydrogenase/reductase family 47C, member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HSD17B14
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIR
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 51171
• Target Species: Human
• Isotype: IgG

For Research Use Only