14-3-3 zeta/delta Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92813-0.1ml

Product Code. 18689021

Description

14-3-3 zeta/delta Polyclonal antibody specifically detects 14-3-3 zeta/delta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: 14-3-3 zeta/delta
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin
• Gene Alias: KCIP-1MGC126532,14-3-3-zeta, MGC111427, MGC138156, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide, zeta polypeptide
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 146-245 of human 14-3-3 zeta/delta (NP_003397.1). QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 7534
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified