AK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49393

Product Code. 18647397

Description

AK3 Polyclonal antibody specifically detects AK3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: AK3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Adenylate kinase 3 alpha-like 1, adenylate kinase 3 like 1, adenylate kinase 3adenylate kinase 6, AK 3, AK6, AKL3L, AKL3L1, EC 2.7.4, EC 2.7.4.10, FIX, GTP:AMP phosphotransferase, mitochondrial
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLD
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 50808
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified