Novus Biologicals SGLT2/SLC5A2 Antibody (3G8), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006524-M01

Product Code. 18450750

Description

SGLT2/SLC5A2 Monoclonal antibody specifically detects SGLT2/SLC5A2 in Human samples. It is validated for Western Blot, ELISA, ELISA

Specifications

• Antigen: SGLT2/SLC5A2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Alias: Low affinity sodium-glucose cotransporter, Na(+)/glucose cotransporter 2, SGLT2sodium/glucose cotransporter 2, solute carrier family 5 (sodium/glucose cotransporter), member 2, solute carrier family 5 (sodium/glucose transporter), member 2, Solute carrier family 5 member 2
• Immunogen: SLC5A2 (NP_003032.1, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
• Quantity: 0.1 mg
• Research Discipline: Apoptosis, Cancer, Tumor Suppressors
• Gene ID (Entrez): 6524
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 3G8
• Formulation: In 1x PBS, pH 7.4
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified