NPAS2 Antibody (3B1), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00004862-M04

Product Code. 18380219

Description

NPAS2 Monoclonal antibody specifically detects NPAS2 in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: NPAS2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Accession No.: NP_002509
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4862
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA
• Clone: 3B1
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: Basic-helix-loop-helix-PAS protein MOP4, BHLHE9, bHLHe9MGC71151, Class E basic helix-loop-helix protein 9, Member of PAS protein 4, member of PAS superfamily 4, MOP4PAS domain-containing protein 4, neuronal PAS domain protein 2, neuronal PAS domain-containing protein 2, Neuronal PAS2, PASD4FLJ23138
• Immunogen: NPAS2 (NP_002509, 646 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified