Filtered Search Results
Search results for "bio bin"
Econix™ Bio-bins™ Yellow Paper Based Non-Sharps Infectious Clinical Waste Containers for Incineration Only
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Use Econix™ Bio-bins™ The Bio-bin™ is a Paper based Non-sharps Container used to dispose of single use implements, tips, petri dishes, pads and other lab waste (excluding needles and blades) and reduce over filling issues for your non-sharp clinical waste. The Bio-bin has a built-in temporary seal, absorbent mat and is waterproof.
Product Type | Non-Sharps Waste Container |
---|---|
Color | Yellow |
Certifications/Compliance | UN3291 |
For Use With (Application) | Infectious Waste |
Closure Type | Temporary and Permanent |
Econix™ Bio-bins™ Plain Paper Based Non-Sharps Waste Containers for General Use Only
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Use Econix™ Bio-bin™ General/Non Infectious Bio-bin™ to dispose of single use implements and reduce over filling issues for your non-sharp clinical waste. For use with general waste.
Color | White,Green |
---|---|
For Use With (Application) | For General Waste |
Autoclavable | Autoclavable,Autoclavable |
Econix™ Bio-bins™ Tiger Stripe Paper Based Non-Sharps Offensive Waste Containers for Deep Landfill / Energy from Waste Only
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Use Econix™ Bio-bins™ The Bio-bin™ is a Paper based Non-sharps Container used to dispose of single use implements, tips, petri dishes, pads and other lab waste (excluding needles and blades) and reduce over filling issues for your non-sharp clinical waste. The Bio-bin has a built-in temporary seal, absorbent mat and is waterproof.
Product Type | Non-Sharps Waste Container |
---|---|
Color | Tiger Stripe |
Material | Cardboard |
Certifications/Compliance | UN3291 |
For Use With (Application) | Offensive Clinical Waste |
Closure Type | Temporary and Permanent |
Econix™ Bio-bins™ Orange Paper Based Non-Sharps Infectious Clinical Waste Containers for Alternative Treatment / Incineration
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Use Econix™ Bio-bins™ The Bio-bin™ is a Paper based Non-sharps Container used to dispose of single use implements, tips, petri dishes, pads and other lab waste (excluding needles and blades) and reduce over filling issues for your non-sharp clinical waste. The Bio-bin has a built-in temporary seal, absorbent mat and is waterproof.
Product Type | Non-Sharps Waste Container |
---|---|
Color | Orange |
Certifications/Compliance | UN3291 |
For Use With (Application) | For Low Risk Infectious Waste |
Autoclavable | Autoclavable |
Closure Type | Temporary and Permanent |
Econix™ Bio-bin™ Infectious Waste Bins
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Use Econix™Bio-bin™ Infectious Waste Bins in the field (e.g. Community nursing) or for private first aid providers. The 1L bin is the ideal size to be used for small amounts of offensive waste as well as in labs where limited space is available such as inside fume cupboards.
Econix™ Stainless Steel Z-Stand for Econix™ 6L Bio-bin
Use Z-stand to provide easy access to filling and packing your 6L Bio-bin™ container.
Econix™ Bio-bins™ Single M Stand for 30 L Bio-bin Waste Container - Stainless Steel
Use Econix™ Stainless Steel 'M' stand designed to allow the 30 L Bio-bin™ to tilt at approximately 15 degrees for easy filling of tall thin items like pipettes and other general non-sharps laboratory waste.
Econix™ Bio-bins™ Purple Paper Based Non-Sharps Cytotoxic/Cytostatic Waste Bio-Bin for Incineration Only
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Use Econix™ Bio-bins™ The Bio-bin™ is a Paper based Non-sharps Container used to dispose of your Cytotoxic and Cytostatic waste including single use implements, tips, petri dishes, pads and other lab waste (excluding needles and blades) and reduce over filling issues for your non-sharp clinical waste. The Bio-bin™ has a built-in temporary seal, absorbent mat and is waterproof.
Product Type | Non-Sharps Waste Container |
---|---|
Color | Purple |
Certifications/Compliance | UN3291 |
For Use With (Application) | For Cytotoxic and Cytostatic Waste |
Autoclavable | Autoclavable |
Closure Type | Temporary and Permanent |
Econix™ Bio-bin™ General/Non Infectious Bins
Use Econix™ Bio-bin™ General/Non Infectious Bins to dispose of single use implements and reduce overfilling issues for your non-sharp clinical waste. Its longer base allows single use lab and surgical instruments to lie flat.
Econix Floor Stand for Bio-Bin 30Ltr - Ss Steel w/Castors
17872514 Floor Stand for Bio-Bin 30Ltr - Ss Steel w/Castors
Econix X10 fold-flat Bio-bin 30Ltr Red (Anatomical)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
17808323 X10 fold-flat Bio-bin 30Ltr Red (Anatomical)
Econix M Stand fro Bio-bin 30Ltr - Stainless Steel
18823021 M Stand fro Bio-bin 30Ltr - Stainless Steel
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | MBD5 |
Gene Symbols | MBD5 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | KIAA1461, methyl-CpG binding domain protein 5, methyl-CpG-binding domain protein 5, methyl-CpG-binding protein MBD5, MRD1 |
Gene ID (Entrez) | 55777 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | TOM1 |
Gene Symbols | TOM1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3 |
Gene ID (Entrez) | 10043 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | CAH18463 |
Antigen | SBF1 |
Gene Symbols | SBF1 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 91 kDa |
Gene Alias | myotubularin-related protein 5, DENND7A, MTMR5, SET binding factor 1 |
Gene ID (Entrez) | 6305 |
Immunogen | The immunogen for this antibody is SBF1 - C-terminal region. Peptide sequence YLEPTEDLAPAQEVGEAPSQEDERSALDVASEQRRLWPTLSREKQQELVQ. |
Classification | Polyclonal |
Primary or Secondary | Primary |