Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search results for "N/2272"
1
–
2
of
2
results
![](/catalog/search/static/resources/images/icons/back_to_top_icon.png)
Nitric Acid 68% d=1.42, Primar Plus™, for Trace Metal Analysis, Fisher Chemical™
CAS: 7697-37-2 Molecular Formula: HNO3 Molecular Weight (g/mol): 63.01 MDL Number: MFCD00011349 InChI Key: GRYLNZFGIOXLOG-UHFFFAOYSA-N Synonym: hydrogen nitrate,aqua fortis,azotic acid,salpetersaeure,rfna,acidum nitricum,nital,acide nitrique,nitrous fumes,nitryl hydroxide PubChem CID: 944 ChEBI: CHEBI:48107 IUPAC Name: nitric acid SMILES: O[N+]([O-])=O
PubChem CID | 944 |
---|---|
CAS | 7697-37-2 |
Molecular Weight (g/mol) | 63.01 |
ChEBI | CHEBI:48107 |
MDL Number | MFCD00011349 |
SMILES | O[N+]([O-])=O |
Synonym | hydrogen nitrate,aqua fortis,azotic acid,salpetersaeure,rfna,acidum nitricum,nital,acide nitrique,nitrous fumes,nitryl hydroxide |
IUPAC Name | nitric acid |
InChI Key | GRYLNZFGIOXLOG-UHFFFAOYSA-N |
Molecular Formula | HNO3 |
Abnova™ Human NAG Partial ORF (NP_056993, 2272 a.a. - 2371 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Form | Liquid |
---|---|
Common Name | NAG |
Molecular Weight (g/mol) | 36.74kDa |
Gene Symbol | NAG |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Expression System | wheat germ expression system |
For Use With (Application) | Antibody Production,ELISA,Protein Array,Western Blot |
Name | NAG (Human) Recombinant Protein (Q01) |
Accession Number | NP_056993 |
Regulatory Status | RUO |
Gene Alias | DKFZp586G1219/FLJ40407 |
Gene ID (Entrez) | 51594 |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Immunogen | LEQITAVTTVNDSNCDQELLSLLLDAKLLVKCVSTPFYPRIVDHLLASLQQGRWDAEELGRHLREAGHEAEAGSLLLAVRGTHQAFRTFSTALRAAQHWV |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Protein Tag | GST |
Species | Wheat Germ (in vitro) |
Recombinant | Recombinant |
Showing the most precise results for "N/2272".
Expand this search
to show all possible results.