accessibility menu, dialog, popup

UserName

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (393)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

nucleic acid purification

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (2)
  • (5)
  • (365)
  • (8)
  • (13)

special programs

  • (14)

Applications

  • (3)
  • (159)
  • (189)
  • (166)
  • (7)
  • (205)
  • (117)
Show all

Classification

  • (315)
  • (78)

Conjugate

  • (6)
  • (2)
  • (15)
  • (12)
  • (13)
  • (14)
  • (14)
Show all

Host Species

  • (6)
  • (270)
  • (115)
  • (2)

Quantity

  • (2)
  • (7)
  • (2)
  • (264)
  • (18)
  • (1)
  • (1)
Show all

Target Species

  • (95)
  • (5)
  • (5)
  • (5)
  • (380)
  • (120)
  • (24)
Show all

Isotype

  • (125)
  • (31)
  • (134)
  • (8)
  • (30)
  • (28)
  • (33)
Show all

Regulatory Status

  • (337)

Form

  • (5)
  • (1)
  • (286)
  • (1)
1 – 15 of 362 results
1

Invitrogen™ DJ-1 Monoclonal Antibody (4H4)
GREENER_CHOICE

Mouse Monoclonal Antibody

2

Invitrogen™ DJ-1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. O88767, Q99497, Q99LX0
Isotype IgG
Concentration Conc. Not Determined
Antigen DJ-1
Gene Symbols Park7
Regulatory Status RUO
Gene Alias CAP1; Contraception-associated protein 1; CTA-215D11.1; dj1; DJ-1; DJ-1 protein; early onset 7; epididymis secretory sperm binding protein Li 67p; fertility protein SP22; FLJ27376; FLJ34360; FLJ92274; HEL-S-67p; hypothetical protein LOC449674; maillard deglycase; Oncogene DJ1; OTTHUMP00000001350; OTTHUMP00000001351; PARK7; PARK7 GENE; PARK7/DJ1; parkinson disease (autosomal recessive, early onset) 7; Parkinson disease 7; Parkinson disease protein 7; Parkinson disease protein 7 homolog; Parkinson disease protein 7 homolog; protein/nucleic acid deglycase DJ-1; parkinson protein 7; Parkinsonism associated deglycase; parkinsonism-associated deglycase; Protein CAP1; protein deglycase DJ-1; protein deglycase DJ-1zDJ-1; Protein DJ-1; protein DJ-1-like protein; protein DJ-1zDJ-1; Protein/nucleic acid deglycase DJ-1; RNA-binding protein regulatory subunit; SP22; zDJ-1; zgc:103725
Gene Park7
Product Type Antibody
Gene ID (Entrez) 11315, 117287, 57320
Formulation whole serum with 5mM sodium azide
Immunogen Full length recombinant human DJ1 expressed in and purified from E. coli.
Classification Polyclonal
Primary or Secondary Primary
3

Invitrogen™ DJ-1 Monoclonal Antibody (4H4)
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Bovine
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry,Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. Q5E946, Q99497
Isotype IgG1
Concentration 1 mg/mL
Antigen DJ-1
Gene Symbols Park7
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias CAP1; Contraception-associated protein 1; CTA-215D11.1; dj1; DJ-1; DJ-1 protein; early onset 7; epididymis secretory sperm binding protein Li 67p; fertility protein SP22; FLJ27376; FLJ34360; FLJ92274; HEL-S-67p; hypothetical protein LOC449674; maillard deglycase; Oncogene DJ1; OTTHUMP00000001350; OTTHUMP00000001351; PARK7; PARK7 GENE; PARK7/DJ1; parkinson disease (autosomal recessive, early onset) 7; Parkinson disease 7; Parkinson disease protein 7; Parkinson disease protein 7 homolog; Parkinson disease protein 7 homolog; protein/nucleic acid deglycase DJ-1; parkinson protein 7; Parkinsonism associated deglycase; parkinsonism-associated deglycase; Protein CAP1; protein deglycase DJ-1; protein deglycase DJ-1zDJ-1; Protein DJ-1; protein DJ-1-like protein; protein DJ-1zDJ-1; Protein/nucleic acid deglycase DJ-1; RNA-binding protein regulatory subunit; SP22; zDJ-1; zgc:103725
Gene Park7
Product Type Antibody
Gene ID (Entrez) 11315, 511268
Formulation PBS with 50% glycerol and 5mM sodium azide
Immunogen Full length recombinant human DJ1 expressed in and purified from E. coli.
Classification Monoclonal
Primary or Secondary Primary
Clone 4H4
4

MNAB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunofluorescence
Form Purified
Isotype IgG
Research Discipline Zinc Finger
Antigen MNAB
Regulatory Status RUO
Purification Method Protein A purified
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gene Alias FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164
Gene ID (Entrez) 54542
Formulation PBS (pH 7.2) and 40% Glycerol
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
Classification Polyclonal
Primary or Secondary Primary