| Target Species |
Human |
| Host Species |
Rabbit |
| Conjugate |
Unconjugated |
| Applications |
Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype |
IgG |
| Research Discipline |
Signal Transduction |
| Antigen |
DTX1 |
| Gene Symbols |
DTX1 |
| Regulatory Status |
RUO |
| Purification Method |
Affinity Purified |
| Dilution |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gene Alias |
deltex homolog 1 (Drosophila), deltex1, hDTX1, hDx-1, protein deltex-1 |
| Gene ID (Entrez) |
1840 |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP |
| Classification |
Polyclonal |
| Primary or Secondary |
Primary |
| Test Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |