Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
941,676
résultats
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Applications | Western Blot |
|---|---|
| Isotype | IgG1 κ |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Concentration | 0.9 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | Q14674 |
| Dilution | Western Blot 1:500 |
| Immunogène | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 9700 |
| Méthode de purification | Protein G purified |
| Disciplines de recherche | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | ESPL1 |
| Alias de gène | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Clone | XJ11-1B12 |
| Antigène | Separase |
| Protéine | alpha-Synuclein |
|---|---|
| Conditions de stockage | Store at -80C. Avoid freeze-thaw cycles. |
| Catégorie de recherche | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Pureté ou qualité | >95%, by SDS-PAGE |
| Identification génétique (Entrez) | 6622 |
| Symbole de gène(s) | SNCA |
| Formule | PBS pH 7.4 |
| Alias de gène | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| À utiliser avec (application) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Symboles de gène(s) | TP53BP1 |
|---|---|
| Alias de gène | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
| Applications | Western Blot,Immunocytochemistry,Immunofluorescence,KnockDown |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| État réglementaire | RUO |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, KnockDown Validated |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 5893 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Breast Cancer, DNA Repair, Homologous Recombination |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | RAD52 |
| Alias de gène | DNA repair protein RAD52 homolog, RAD52 (S. cerevisiae) homolog, RAD52 homolog (S. cerevisiae), recombination protein RAD52, rhabdomyosarcoma antigen MU-RMS-40.23 |
| Antigène | RAD52 |
| État réglementaire | RUO |
|---|---|
| Espèces hôtes | Rabbit |
| Applications | Immunocytochemistry,Immunofluorescence |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| État réglementaire | RUO |
| Immunogène | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQ |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 1763 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | DNA2 |
| Formule | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Alias de gène | DNA replication ATP-dependent helicase-like homolog, DNA replication helicase 2 homolog (yeast), DNA2 DNA replication helicase 2-like (yeast), EC 3.6.1, EC 3.6.4.12, FLJ10063, KIAA0083DNA2LDNA2-like helicase, MGC133297 |
| Antigène | DNA2 |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
| Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
|---|---|
| Immunogène | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
| Isotype | IgG |
| Méthode de purification | Affinity Purified |
| Espèces cibles | Pig,Avian,Bacteria,Bovine,Primate,Rabbit,Zebrafish |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | MAP1LC3B |
| Contenu et stockage | Store at -20°C. |
| Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:10-1:20, Knockdown Validated |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 24145 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | PANX1 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | MGC21309, MRS1innexin, pannexin 1, pannexin-1, PX1, UNQ2529 |
| Antigène | Pannexin-1 |
Sirtuin 1/SIRT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 23411 |
| Méthode de purification | Affinity Purified |
| Disciplines de recherche | Apoptosis, Chromatin Research, DNA Repair, Epigenetics, Histone Deacetylases |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | SIRT1 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | EC 3.5.1, S. cerevisiae, homolog) 1, sirtuin 1 |
| Antigène | Sirtuin 1/SIRT1 |
Carbonic Anhydrase IX/CA9 Antibody (2D3) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
| Applications | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
|---|---|
| Isotype | IgG1 |
| Conjugué | Unconjugated |
| Espèces cibles | Human,Mouse |
| Concentration | 1.0 mg/mL |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Numéro d’ordre du gène | Q16790 |
| Dilution | Western Blot 1:2000, Flow Cytometry 1:200-1:400, ELISA 1:10000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:1000, Flow (Intracellular) 1 ug/mL, CyTOF-ready |
| Immunogène | Purified recombinant fragment of human Carbonic Anhydrase IX expressed in E. coli. [UniProt# Q16790] |
| Poids moléculaire de l’antigène | 50 kDa |
| Classification | Monoclonal |
| Identification génétique (Entrez) | 768 |
| Méthode de purification | Protein A or G purified |
| Disciplines de recherche | Cancer, Cellular Markers, HIF Target Genes, Hypoxia, Lipid and Metabolism, Signal Transduction |
| Espèces hôtes | Mouse |
| Symboles de gène(s) | CA9 |
| Alias de gène | CA-IX, CAIXcarbonic anhydrase 9, Carbonate dehydratase IX, carbonic anhydrase IXpMW1, carbonic dehydratase, EC 4.2.1.1, G250, Membrane antigen MN, MNRCC-associated antigen G250, P54/58N, RCC-associated protein G250, Renal cell carcinoma-associated antigen G250 |
| Clone | 2D3 |
| Antigène | Carbonic Anhydrase IX/CA9 |
| Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
|---|---|
| Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| État réglementaire | RUO |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:TEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPR |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 79838 |
| Méthode de purification | Affinity Purified |
| Espèces hôtes | Rabbit |
| Symboles de gène(s) | TMC5 |
| Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Alias de gène | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Antigène | TMC5 |
| Applications | Western Blot |
|---|---|
| Isotype | IgG |
| Conjugué | Unconjugated |
| Espèces cibles | Human |
| Primaire ou secondaire | Primary |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Forme | Purified |
| État réglementaire | RUO |
| Dilution | Western Blot 1:500-1:2000 |
| Immunogène | Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2). YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA |
| Classification | Polyclonal |
| Identification génétique (Entrez) | 79838 |
| Méthode de purification | Affinity purified |
| Disciplines de recherche | Cell Biology |
| Espèces hôtes | Rabbit |
| Formule | PBS (pH 7.3), 50% glycerol |
| Alias de gène | FLJ13593, transmembrane channel-like 5, transmembrane channel-like protein 5 |
| Antigène | TMC5 |