ZNF654 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-10966-100UL

Product Code. 18317245

Description

ZNF654 Polyclonal specifically detects ZNF654 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF654
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ10997, FLJ21142, zinc finger protein 654
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF654 (NP_060763). Peptide sequence GRKFRNRGLMQKHLKNHVKKIQRQQIAAAQQDDQEVTALEEINCSSSSIS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55279
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.