missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF584 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF584 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF584 Polyclonal specifically detects ZNF584 in Human samples. It is validated for Western Blot.Spécification
| ZNF584 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ39899, zinc finger protein 584 | |
| ZNF584 | |
| IgG | |
| 37 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EAW72588 | |
| 201514 | |
| Synthetic peptide directed towards the middle region of human ZNF584. Peptide sequence HSEERPFRCPTGRSAFKKSAHINPRKIHTGETAHVCNECGKAFSYPSKLR. | |
| Primary |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit